PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca5456.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family NF-YB
Protein Properties Length: 88aa    MW: 9820.52 Da    PI: 4.9066
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca5456.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB66.36e-211184376
      NF-YB  3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGf 76
               ++d+ lP a +++i+k++lPa+ ++++da++++ ec +efi +v+se+++ c++e++kti+++ +l al   G+
  Dca5456.1 11 KEDASLPKATMTKIIKEMLPAEVRVARDAQDLLIECCVEFINLVSSESNEVCNKEEKKTIAPEHVLKALEGKGY 84
               6899****************************************************************988776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.107.9E-29884IPR009072Histone-fold
SuperFamilySSF471139.22E-261283IPR009072Histone-fold
PfamPF008086.1E-231479IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 88 aa     Download sequence    Send to blast
MEPMDIVGKT KEDASLPKAT MTKIIKEMLP AEVRVARDAQ DLLIECCVEF INLVSSESNE  60
VCNKEEKKTI APEHVLKALE GKGYAMLR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_B1e-2612851284Transcription Regulator NC2 beta chain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011097000.11e-49PREDICTED: protein Dr1 homolog
RefseqXP_011096999.11e-49PREDICTED: protein Dr1 homolog
RefseqXP_010491444.12e-49PREDICTED: protein Dr1 homolog
RefseqXP_013730182.12e-49PREDICTED: protein Dr1 homolog
RefseqXP_013730175.12e-49PREDICTED: protein Dr1 homolog
RefseqXP_013612247.12e-49PREDICTED: protein Dr1 homolog
RefseqXP_013612245.12e-49PREDICTED: protein Dr1 homolog
RefseqXP_013612244.12e-49PREDICTED: protein Dr1 homolog
RefseqXP_013612243.12e-49PREDICTED: protein Dr1 homolog
RefseqXP_013600318.12e-49PREDICTED: protein Dr1 homolog
RefseqXP_013600317.12e-49PREDICTED: protein Dr1 homolog
SwissprotP495926e-50NC2B_ARATH; Protein Dr1 homolog
TrEMBLA0A078G5092e-49A0A078G509_BRANA; BnaC09g47720D protein
TrEMBLA0A0D3EGX42e-49A0A0D3EGX4_BRAOL; Uncharacterized protein
STRINGAT5G08190.16e-49(Arabidopsis thaliana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08190.11e-52nuclear factor Y, subunit B12